This is a working overview of Mass spectrometry, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-04-03 and is reviewed periodically as new material appears.
After a solvent is added, the vial is typically swirled or gently inverted rather than shaken vigorously. Shaking can introduce air and shear forces that promote foaming or aggregation, especially for longer peptides. Dissolution may take several minutes, and the solution should become clear unless the peptide is intentionally in suspension. Concentration is calculated from the mass of peptide stated on the vial label divided by the total liquid volume. If the dried peptide contains salts or counterions, the actual peptide content may be lower than the nominal mass.
Reconstitution is the process of adding a liquid to a lyophilized peptide so that the dried material dissolves into solution. Lyophilization removes water from a frozen peptide preparation under reduced pressure, leaving a porous solid or powder. The dried form often has greater long-term stability than a liquid because hydrolysis and oxidation are slowed. In laboratory work, reconstitution is usually the first step before dilution, analysis, or further experiments. The result is a stock solution whose concentration depends on the volume of solvent added and the amount of peptide in the vial.
Solvent choice depends on the peptide's sequence, charge, and solubility profile. Sterile water is common for freely soluble peptides, while aqueous buffers or dilute acid or base may be needed for others. Some sequences contain hydrophobic regions that resist water alone and require a small amount of organic co-solvent. The solvent's pH can affect charge state, aggregation, and stability. Because peptides vary widely, no single universal reconstitution liquid exists, and suppliers often provide a recommended solvent based on testing of a specific lot or sequence.
Quality verification after reconstitution may include visual inspection, pH measurement, and chromatographic analysis. Reverse-phase high-performance liquid chromatography can reveal degradation peaks, while mass spectrometry can confirm molecular identity. Concentration may be estimated from the weighed peptide mass or determined by amino acid analysis, UV absorbance, or quantitative chromatography. Documentation of solvent, volume, date, and storage conditions supports traceability and reproducibility. Records also help identify when a solution was prepared and whether it has exceeded an established in-house shelf life.
After a dried peptide is dissolved, the resulting solution is treated as a distinct material with its own stability profile. Temperature, pH, ionic strength, and peptide concentration all influence how long the solution remains suitable for its intended laboratory use. Some sequences are prone to oxidation, deamidation, or aggregation. Because these processes vary widely, no single storage condition applies to every peptide. Buffer composition and light exposure can also shift degradation rates.
| Property | Value | Notes |
|---|---|---|
| Physical state before solvent | Lyophilized powder or cake | Freeze-drying removes water under vacuum and leaves a porous solid. |
| Common reconstitution liquid | Sterile water or aqueous buffer | Compatibility depends on peptide sequence, charge, and pH requirements. |
| Typical solution pH | pH 3 to 7 | Acidic or slightly acidic conditions are common; some peptides need other ranges. |
| Appearance after dissolution | Clear to slightly opalescent solution | Cloudiness can indicate incomplete dissolution, aggregation, or undissolved excipients. |
| Concentration basis | Mass of peptide per volume of solvent | Label mass may include counterions or salts, so peptide content can differ. |
Cold storage slows most degradation but does not stop it. Reconstituted solutions are commonly divided into aliquots and held at -20 °C or -80 °C, depending on the peptide. Repeated freeze-thaw cycles can promote aggregation or precipitation, so single-use aliquots are preferred. Some peptides tolerate refrigeration for short intervals, while others require freezing immediately. Light-sensitive residues may need amber or foil-wrapped containers. The optimal condition remains peptide-specific and should be supported by stability data.
Analytical checks can detect changes in a reconstituted stock over time. Reverse-phase high-performance liquid chromatography can show loss of main peak, new impurity peaks, or altered retention. Mass spectrometry confirms molecular identity and can reveal modifications. Visual inspection for particles, color change, or turbidity provides a simple first check. If a solution shows signs of degradation or contamination, it is typically discarded rather than re-purified in a routine laboratory.
Once a peptide is dissolved, its solution is generally less stable than the dry powder. Chemical pathways such as hydrolysis, oxidation, and deamidation can alter the molecule, while physical processes can form aggregates or cause adsorption to container walls. The rate depends on pH, buffer composition, temperature, concentration, and the specific sequence. Aqueous stocks are therefore kept cold and used within a defined period. Stability testing is usually performed for each peptide rather than assumed from a general rule.
After a peptide is reconstituted, analytical checks can confirm identity, concentration, and purity. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and can estimate purity by peak area. Mass spectrometry provides a mass value that supports sequence identity, while ultraviolet absorbance at 214 or 280 nanometers is often used for concentration estimation when the extinction coefficient is known. These methods answer different questions and are complementary. A single measurement rarely establishes full quality, because the same sample can appear acceptable by one method and fail another.
Concentration calculations depend on the amount of peptide present in the vial and the volume of solvent added. Lyophilized preparations often contain counterions, salts, or residual water, so the labeled mass may not equal the mass of the peptide itself. This difference can produce a calculated concentration that is higher than the true peptide concentration. Analytical determination of peptide content, rather than reliance on the vial label alone, reduces this source of error. Uncertainty in volume measurement also contributes, especially when small liquid volumes are handled.
CH2=CHCH2Cl + NaOH → CH2=CHCH2OH + NaCl Allyl alcohol can also be made by the rearrangement of propylene oxide, a reaction that is catalyzed by potassium alum at high temperature. The advantage of this method relative to the allyl chloride route is that it does not generate salt. Also avoiding chloride-containing intermediates is the "acetoxylation" of propylene to allyl acetate:
Nearly 40,000 workers and harvesters in the provinces of Newfoundland and Labrador applied for the federal relief program TAGS (the Atlantic Groundfish Strategy). Abandoned and rusting fishing boats still litter the coasts of Newfoundland and the Canadian northwest to this day. The fishery minister, John Crosbie, after delivering a speech on the day before the declaration of the moratorium, or July 1, 1992, was publicly heckled and verbally harassed by disgruntled locals at a fishing village. The moratorium, initially lasting for only two years, was indefinitely extended after it became evident that cod populations had not recovered at all but, instead, had continued to spiral downward in both size and numbers, due to the damage caused by decades of destructive fishing practices, and the fact that the moratorium had permitted exceptions for food fisheries for "personal consumption" purposes to this very day. Some 12,000 tons of Northwest cod are still being caught every year along the Newfoundland coast by local fishermen. The collapse of the four-million ton biomass, which had persevered through several previous marine extinctions over tens of millions of years, in a timespan of no more than 20 years, is oft-cited by researchers as one of the most visible examples of the phenomenon of the "Tragedy of the Commons." Factors which had been implicated as contributing to the collapse include: overfishing; government mismanagement; the disregard of scientific uncertainty; warming habitat waters; declining reproduction; and plain human ignorance.
is the model-dependent probability for this particular decay channel (or branching ratio). In the early 80s several experiments started. Some were based on calorimeter-type detectors, including the particle experiments at Kolar Gold Fields (India), NUSEX (Mont Blanc Tunnel, Italy), Fréjus (Fréjus Road Tunnel, France), Soudan (Minnesota, US); while other were water Cherenkov detectors: IMB (Ohio, US), HPW (Utah, US), KamiokaNDE (Japan). The IMB experiment published a remarkable limit for the p → e+π0 decay channel
Its objectives include comparison of survival, cardiovascular mortality and morbidity, pharmacological activity (e.g., suppression of testosterone levels), other side effects and toxicities, and quality of life. In addition to the PATCH trial, the Systemic Therapy in Advancing or Metastatic Prostate Cancer: Evaluation of Drug Efficacy (STAMPEDE) study added a high-dose estradiol patches arm (~2,000 men) in July 2017. Estradiol patches are associated with local skin reactions and such as irritation in 14.2% of individuals (with reservoir patches), mild-to-moderate erythema (redness) in 50 to 60% of individuals, and allergic reactions due to cutaneous sensitization. Up to 5% of people using reservoir patches may discontinue therapy due to skin reactions. Visible adhesive residues are also often left by estradiol patches following their removal. Transdermal estradiol gel can serve as an alternative to transdermal estradiol patches for individuals who experience intolerable skin reactions with them. Estradiol patches should not be applied to the breast as this may result in high local levels of estradiol in the breasts and hence an increased likelihood of breast tenderness.
== Function == Androgens that bind to and activate the androgen receptor have numerous physiological functions which can broadly divided into androgenic (male sexual development) and anabolic (building muscle and bone). The anabolic effects are important in both males and females, although females have lower circulating levels of androgens. The physiologically most important androgens are testosterone (T) and dihydrotestosterone (DHT), which are considered classical androgens because their role in human health was discovered in 1930s. However, much later, in 2010s, the role in human health of 11-oxygenated androgens was established, namely, of 11-ketotestosterone (11KT) and 11-ketodihydrotestosterone (11KDHT), that both bind and activate the human androgen receptor with affinities, potencies, and efficacies that are similar to that of testosterone (T) and DHT, respectively, although 11-oxygenated androgens were long known to be principal androgens in teleost fishes. The main biochemical route to T and DHT is the canonical (classical) pathway that proceeds from pregnenolone (P5). Alternatively, DHT but not T can be produced through a backdoor pathway that proceeds from 17α-hydroxyprogesterone (17OHP) or progesterone (P4). The function of androgen backdoor pathways is to produce physiologically significant androgens in normal conditions where the conventional pathway is insufficient, such as in male early sexual differentiation. Sexual differentiation is a process by which hormones determine anatomic phenotype, mainly the development of the reproductive organs.
Sources: en.wikipedia.org
===== Platelet-coagulation factor interactions: coagulation facilitation ===== Platelet activation causes its membrane surface to become negatively charged. One of the signaling pathways turns on scramblase, which moves negatively charged phospholipids from the inner to the outer platelet membrane surface. These phospholipids then bind the tenase and prothrombinase complexes, two of the sites of interplay between platelets and the coagulation cascade. Calcium ions are essential for the binding of these coagulation factors. In addition to interacting with vWF and fibrin, platelets interact with thrombin, Factors X, Va, VIIa, XI, IX, and prothrombin to complete formation via the coagulation cascade. Human platelets do not express tissue factor. Rat platelets do express tissue factor protein and carry both tissue factor pre-mRNA and mature mRNA.
=== NAD+ === NAD+, or nicotinamide adenine dinucleotide, is a dinucleotide, containing two nucleotides. One of the nucleotides it contains is an adenine group, while the other is nicotinamide. In order to reduce this molecule, a hydrogen and two electrons must be added to the 6-carbon ring of nicotinamide; one electron is added to the carbon opposite the positively charged nitrogen, causing a rearrangement of bonds within the ring to give nitrogen more electrons; it will lose its positive charge as a result. The other electron is "stolen" from an additional hydrogen, leaving the hydrogen ion in solution. Reduction of NAD+: NAD+ + 2H+ + 2e− ↔ NADH + H+NAD+ is mostly used in catabolic pathways, such as glycolysis, that break down energy molecules to produce ATP. The ratio of NAD+ to NADH is kept very high in the cell, keeping it readily available to act as an oxidizing agent.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
There has been a global increase in food insecurity and hunger between 2011 and 2020. In 2015, 795 million people (about one in ten people on earth) had undernutrition. It is estimated that between 691 and 783 million people in the world faced hunger in 2022. According to UNICEF, 2.4 billion people were moderately or severely food insecure in 2022, 391 million more than in 2019.
Sources: en.wikipedia.org
Reconstitution means adding a liquid to a dried peptide to form a solution. The dried material is usually a lyophilized powder or cake produced by freeze-drying. The resulting liquid is a stock solution that can be diluted or analyzed further.
Freeze-drying removes water and limits hydrolysis and oxidation during storage. The dried solid is generally more stable and easier to ship than a liquid. It also allows a defined amount of material to be sealed in a single vial.
No. Solubility depends on the amino acid sequence, charge, and hydrophobic content. Some peptides require buffer, dilute acid, dilute base, or a small amount of organic solvent. A supplier's recommended solvent is based on the specific peptide.
Most reconstituted peptide solutions are kept cold, often at 2–8 °C for short-term use. Longer storage may require freezing at -20 °C or below, depending on the peptide. Repeated freeze-thaw cycles can promote aggregation or degradation.