This is a working overview of deamidation, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-09-19 and is reviewed periodically as new material appears.
Quality records typically include a certificate of analysis, batch number, molecular weight, purity result, and recommended storage conditions. After reconstitution, a laboratory log may record solvent, final volume, date, and storage location. Such documentation supports reproducibility and allows later investigation if a preparation behaves unexpectedly. Stability studies often examine purity and concentration over time under defined temperatures, but results are not universally transferable between peptides or formulations. Open questions remain about how best to predict aggregation for specific sequences and how much analytical testing is sufficient for routine laboratory work.
After a peptide is reconstituted, analytical checks can confirm identity, concentration, and purity. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and can estimate purity by peak area. Mass spectrometry provides a mass value that supports sequence identity, while ultraviolet absorbance at 214 or 280 nanometers is often used for concentration estimation when the extinction coefficient is known. These methods answer different questions and are complementary. A single measurement rarely establishes full quality, because the same sample can appear acceptable by one method and fail another.
Concentration calculations depend on the amount of peptide present in the vial and the volume of solvent added. Lyophilized preparations often contain counterions, salts, or residual water, so the labeled mass may not equal the mass of the peptide itself. This difference can produce a calculated concentration that is higher than the true peptide concentration. Analytical determination of peptide content, rather than reliance on the vial label alone, reduces this source of error. Uncertainty in volume measurement also contributes, especially when small liquid volumes are handled.
During reconstitution, solvent penetrates the dry cake and breaks intermolecular contacts that held the peptide in solid form. Dissolution occurs as individual peptide molecules become surrounded by solvent. Hydrophobic regions can associate with one another instead of dissolving, which may produce turbidity or aggregates. pH and ionic strength influence the charge state of ionizable groups and therefore solubility. Buffer salts can help maintain a stable pH, but they can also participate in interactions that affect the final solution.
The concentration of a reconstituted peptide is calculated from the mass of peptide powder and the volume of solvent added. This calculation assumes the powder contains only peptide, but many preparations include counterions, water, or salts. Analytical methods such as ultraviolet absorbance or amino acid analysis can estimate actual peptide content. The relationship between nominal and actual concentration is an area where measurements matter. Open questions remain about how aggregation changes the effective concentration in solution.
| Property | Value | Notes |
|---|---|---|
| Identity method | Mass spectrometry | Compares observed mass with expected peptide mass. |
| Purity method | Reverse-phase HPLC | Peak area percentage under defined conditions. |
| Concentration method | UV absorbance at 214 or 280 nm | Requires known extinction coefficient or calibration. |
| Water content | Karl Fischer titration | Lyophilized powder may contain residual moisture. |
| Counterion content | Ion chromatography or elemental analysis | Affects net peptide mass and calculated concentration. |
Analytical checks can detect changes in a reconstituted stock over time. Reverse-phase high-performance liquid chromatography can show loss of main peak, new impurity peaks, or altered retention. Mass spectrometry confirms molecular identity and can reveal modifications. Visual inspection for particles, color change, or turbidity provides a simple first check. If a solution shows signs of degradation or contamination, it is typically discarded rather than re-purified in a routine laboratory.
Once a peptide is dissolved, its solution is generally less stable than the dry powder. Chemical pathways such as hydrolysis, oxidation, and deamidation can alter the molecule, while physical processes can form aggregates or cause adsorption to container walls. The rate depends on pH, buffer composition, temperature, concentration, and the specific sequence. Aqueous stocks are therefore kept cold and used within a defined period. Stability testing is usually performed for each peptide rather than assumed from a general rule.
Reconstitution involves considerably more than simply adding liquid. The solid must wet completely, and gentle mixing should avoid foaming, which can denature some peptides. Insoluble particles may indicate incomplete dissolution, aggregation, or insoluble excipients. The resulting concentration is calculated from the weighed peptide mass and the final volume, not from the volume of liquid added alone. Because peptides can adsorb to surfaces, container material and transfer steps can influence recovery, especially at low concentrations.
Peptide reconstitution refers to dissolving a dried peptide preparation in a liquid to form a solution. The dried form is often produced by lyophilization, a process that removes water under vacuum from a frozen sample. This yields a porous cake or powder that is more stable for transport and storage than many liquid formulations. The term reconstitution is also often used for other dried biological materials, so context matters greatly.
==== Bones ==== Local osteoporosis occurs in RA around the inflamed joints. It is postulated to be partially caused by inflammatory cytokines. More general osteoporosis is probably contributed to by immobility, systemic cytokine effects, local cytokine release in bone marrow, and corticosteroid therapy.
=== Down syndrome === Adults with Down syndrome had accumulation of amyloid in association with evidence of Alzheimer's disease, including declines in cognitive functioning, memory, fine motor movements, executive functioning, and visuospatial skills.
== Early life and career == Cantelmo was a high school valedictorian. He graduated from Yale University with a degree in molecular biophysics and biochemistry. He worked for about 35 years in the pharmaceutical industry, specializing in high-performance liquid chromatography (HPLC). According to his own accounts and those of family members, he ran three HPLC companies. The last of these was GL Sciences. He left that position prior to the events of 2019. GL Sciences has stated it has no association with Cantelmoism or the use of illegal drugs. Cantelmo had a history of mental health difficulties and prior suicide attempts. He had also used other substances, including mescaline, LSD, and methamphetamine, at earlier points in his life.
=== Pharmacodynamics === Mesocarb has been found to act as a selective dopamine reuptake inhibitor (DRI) by blocking the actions of the dopamine transporter (DAT), and lacks the dopamine release characteristic of stimulants such as dextroamphetamine. It was the most selective DAT inhibitor amongst an array of other DAT inhibitors to which it was compared and, in 2017, was reported as the most selective DAT inhibitor described to date. The affinities (Ki) of mesocarb at the human monoamine transporters in vitro have been reported to be 8.3 nM for the dopamine transporter (DAT), 1,500 nM for the norepinephrine transporter (NET) (181-fold lower than for the DAT), and >10,000 nM for the serotonin transporter (SERT) (>1,205-fold lower than for the DAT). The inhibitory potencies (IC50Tooltip half-maximal inhibitory concentration) of mesocarb at the human monoamine transporters in vitro have been reported to be 0.49 ± 0.14 μM at the DAT, 34.9 ± 14.08 μM at the NET (71-fold lower than for the DAT), and 494.9 ± 17.00 μM at the SERT (1,010-fold lower than for the DAT). In 2021, it was discovered that mesocarb is not a conventional DRI but acts as a DAT allosteric modulator or non-competitive inhibitor. In accordance with its nature as an atypical DAT blocker, the drug has atypical effects relative to conventional DRIs. As an example, it shows greater antiparkinsonian activity relative to other DRIs in animals. Similarly to other DRIs, mesocarb has been found to possess wakefulness-promoting effects.
Sources: en.wikipedia.org
Neptunium also forms a large number of oxide compounds with a wide variety of elements, although the neptunate oxides formed with alkali metals and alkaline earth metals have been by far the most studied. Ternary neptunium oxides are generally formed by reacting NpO2 with the oxide of another element or by precipitating from an alkaline solution. Li5NpO6 has been prepared by reacting Li2O and NpO2 at 400 °C for 16 hours or by reacting Li2O2 with NpO3·H2O at 400 °C for 16 hours in a quartz tube and flowing oxygen. Alkali neptunate compounds K3NpO5, Cs3NpO5, and Rb3NpO5 are all produced by a similar reaction:
British prime minister Keir Starmer said the US could use British bases for "defensive" strikes on Iran and disclosed that Ukrainian and other specialists would aid Gulf efforts to foil Iranian drone strikes. Saudi crown prince Mohammed bin Salman, with US backing, vowed to employ military force against Iranian incursions, calling Iranian strikes "cowardly" due to Saudi airspace being closed to US and Israeli attackers. Trump announced that the US had accepted an Iranian proposal to negotiations. However, Ali Larijani ruled out talks.
The carbon footprint of cattle rearing (see environmental impact of meat production) Use of chemicals in the tanning process (e.g., chromium, phthalate esters, nonyl phenol ethoxylate soaps, pentachlorophenol and solvents) Air pollution due to the transformation process (hydrogen sulfide is formed during mixing with acids and ammonia liberated during deliming, solvent vapors)
In this method, polyvinylpyrrolidone (PVP) is dissolved in water by sonication and mixed with silver colloid particles. Active stirring ensures the PVP has adsorbed to the nanoparticle surface. Centrifuging separates the PVP coated nanoparticles which are then transferred to a solution of ethanol to be centrifuged further and placed in a solution of ammonia, ethanol and Si(OEt4) (TES). Stirring for twelve hours results in the silica shell being formed consisting of a surrounding layer of silicon oxide with an ether linkage available to add functionality. Varying the amount of TES allows for different thicknesses of shells formed. This technique is popular due to the ability to add a variety of functionality to the exposed silica surface.
On April 2, 1958, President Eisenhower reacted to the Soviet space lead in launching the first satellite by recommending to the US Congress that a civilian agency be established to direct nonmilitary space activities. Congress, led by Senate Majority Leader Lyndon B. Johnson, responded by passing the National Aeronautics and Space Act, which Eisenhower signed into law on July 29, 1958. This law turned the National Advisory Committee on Aeronautics into the National Aeronautics and Space Administration (NASA). It also created a Civilian-Military Liaison Committee, appointed by the President, responsible for coordinating the nation's civilian and military space programs. On October 21, 1959, Eisenhower approved the transfer of the Army's remaining space-related activities to NASA. On July 1, 1960, the Redstone Arsenal became NASA's George C. Marshall Space Flight Center, with von Braun as its first director. Development of the Saturn rocket family, which when mature gave the US parity with the Soviets in terms of lifting capability, was thus transferred to NASA.
Sources: en.wikipedia.org
The meridians (经络, jīng-luò) are believed to be channels running from the zàng-fǔ in the interior (里, lǐ) of the body to the limbs and joints ("the surface" [表, biaǒ]), transporting qi and xuĕ. TCM identifies 12 "regular" and 8 "extraordinary" meridians; the Chinese terms being 十二经脉 (shí-èr jīngmài, lit. "the Twelve Vessels") and 奇经八脉 (qí jīng bā mài) respectively. There's also a number of less customary channels branching from the "regular" meridians.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
Downtown Emergency Service Center (DESC), in Seattle, Washington, operates several Housing First programmes which utilize the harm reduction model. University of Washington researchers, partnering with DESC, found that providing housing and support services for homeless alcoholics costs taxpayers less than leaving them on the street, where taxpayer money goes towards police and emergency health care. Results of the study funded by the Substance Abuse Policy Research Program (SAPRP) of the Robert Wood Johnson Foundation appeared in the Journal of the American Medical Association in April 2009. This first controlled assessment in the U.S. of the effectiveness of Housing First, specifically targeting chronically homeless alcoholics, showed that the programme saved taxpayers more than $4 million over the first year of operation. During the first six months, the study reported an average cost-savings of 53 percent (even after considering the cost of administering the housing's 95 residents)—nearly $2,500 per month per person in health and social services, compared to the per month costs of a wait-list control group of 39 homeless people. Further, despite the fact residents are not required to be abstinent or in treatment for alcohol use, stable housing also results in reduced drinking among people experiencing homelessness who recreationally use alcohol.
Tanners usually contain a sunscreen. However, when avobenzone is irradiated with UVA light, it generates a triplet excited state in the keto form which can either cause the avobenzone to degrade or transfer energy to biological targets and cause deleterious effects. It has been shown to degrade significantly in light, resulting in less protection over time. The UV-A light in a day of sunlight in a temperate climate is sufficient to break down most of the compound. It's important to continue wearing SPF while self-tanning, as self-tanner is generally a fake and temporary tan, and your skin is still sensitive to the sun. If avobenzone-containing sunscreen is applied on top of tanner, the photosensitizer effect magnifies the free-radical damage promoted by DHA, as DHA may make the skin especially susceptible to free-radical damage from sunlight, according to a 2007 study led by Katinka Jung of the Gematria Test Lab in Berlin. Forty minutes after the researchers treated skin samples with 20% DHA they found that more than 180 percent additional free radicals formed during sun exposure compared with untreated skin. A toxicologist and lung specialist at the University of Pennsylvania's Perelman School of Medicine (Dr. Rey Panettieri) has commented, "The reason I'm concerned is the deposition of the tanning agents into the lungs could really facilitate or aid systemic absorption -- that is, getting into the bloodstream.
=== Excess and copper antagonism === High levels of molybdenum can interfere with the body's uptake of copper, producing copper deficiency. Molybdenum prevents plasma proteins from binding to copper, and it also increases the amount of copper that is excreted in urine. Ruminants that consume high levels of molybdenum suffer from diarrhea, stunted growth, anemia, and achromotrichia (loss of fur pigment). These symptoms can be alleviated by copper supplements, either dietary and injection. The effective copper deficiency can be aggravated by excess sulfur. Copper reduction or deficiency can also be deliberately induced for therapeutic purposes by the compound ammonium tetrathiomolybdate, in which the bright red anion tetrathiomolybdate is the copper-chelating agent. Tetrathiomolybdate was first used therapeutically in the treatment of copper toxicosis in animals. It was then introduced as a treatment in Wilson's disease, a hereditary copper metabolism disorder in humans; it acts both by competing with copper absorption in the bowel and by increasing excretion. It has also been found to have an inhibitory effect on angiogenesis, potentially by inhibiting the membrane translocation process that is dependent on copper ions. This is a promising avenue for investigation of treatments for cancer, age-related macular degeneration, and other diseases that involve a pathologic proliferation of blood vessels.
Sources: en.wikipedia.org
Ultraviolet absorbance is common when the peptide's extinction coefficient is known. Reverse-phase HPLC with calibration standards can also estimate concentration. Amino acid analysis or quantitative mass spectrometry may be used when higher accuracy is needed.
It usually represents the relative peak area of the target peptide compared with all detected peaks under specific chromatographic conditions. It does not measure biological activity or absolute mass. Different methods or wavelengths can give different purity values.
Yes. Mass spectrometry is widely used because the observed mass can be compared with the expected mass. Peptide mapping or sequence analysis may provide additional confirmation. Identity testing does not by itself establish purity or stability.
Lyophilization removes water to produce a dry peptide preparation. Reconstitution adds a solvent back to that preparation to create a liquid solution. The two processes are complementary steps in the lifecycle of many peptide products.